Anti ATAD2B pAb (ATL-HPA034555)

Atlas Antibodies

SKU:
ATL-HPA034555-25
  • Immunohistochemical staining of human duodenum shows moderate cytoplasmic and nuclear positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATPase family, AAA domain containing 2B
Gene Name: ATAD2B
Alternative Gene Name: KIAA1240
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052812: 69%, ENSRNOG00000058973: 63%
Entrez Gene ID: 54454
Uniprot ID: Q9ULI0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEVVSFCDSGDKCSSEQKILLEDQSKEKPETSTENHGDDLEKLEALECSNNEKLEPGSDVEVKDAELDKEGASKVKKYRK
Gene Sequence LEVVSFCDSGDKCSSEQKILLEDQSKEKPETSTENHGDDLEKLEALECSNNEKLEPGSDVEVKDAELDKEGASKVKKYRK
Gene ID - Mouse ENSMUSG00000052812
Gene ID - Rat ENSRNOG00000058973
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATAD2B pAb (ATL-HPA034555)
Datasheet Anti ATAD2B pAb (ATL-HPA034555) Datasheet (External Link)
Vendor Page Anti ATAD2B pAb (ATL-HPA034555) at Atlas Antibodies

Documents & Links for Anti ATAD2B pAb (ATL-HPA034555)
Datasheet Anti ATAD2B pAb (ATL-HPA034555) Datasheet (External Link)
Vendor Page Anti ATAD2B pAb (ATL-HPA034555)