Anti ATAD2 pAb (ATL-HPA029424 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA029424-25

• 
• 
• 

Protein Description: ATPase family, AAA domain containing 2
Gene Name: ATAD2
Alternative Gene Name: CT137, DKFZp667N1320, MGC29843, MGC5254, PRO2000
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022360: 82%, ENSRNOG00000025604: 82%
Entrez Gene ID: 29028
Uniprot ID: Q6PL18
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
• Gene Sequence: TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
• Gene ID - Mouse: ENSMUSG00000022360
• Gene ID - Rat: ENSRNOG00000025604
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATAD2 pAb (ATL-HPA029424 w/enhanced validation) – 4 Found

Raeder, Maria B; Birkeland, Even; Trovik, Jone; Krakstad, Camilla; Shehata, Shyemaa; Schumacher, Steven; Zack, Travis I; Krohn, Antje; Werner, Henrica Mj; Moody, Susan E; Wik, Elisabeth; Stefansson, Ingunn M; Holst, Frederik; Oyan, Anne M; Tamayo, Pablo; Mesirov, Jill P; Kalland, Karl H; Akslen, Lars A; Simon, Ronald; Beroukhim, Rameen; Salvesen, Helga B. Integrated genomic analysis of the 8q24 amplification in endometrial cancers identifies ATAD2 as essential to MYC-dependent cancers. Plos One. 8(2):e54873. 

Wan, Wei-Na; Zhang, Yi-Xia; Wang, Xue-Mei; Liu, Yan-Jun; Zhang, Yu-Qin; Que, Yan-Hong; Zhao, Wen-Jing. ATAD2 is highly expressed in ovarian carcinomas and indicates poor prognosis. Asian Pacific Journal Of Cancer Prevention : Apjcp. 15(6):2777-83. 

Liu, Qun; Liu, Heshu; Li, Lina; Dong, Xiaomei; Ru, Xiaoli; Fan, Xiana; Wen, Tao; Liu, Jian. ATAD2 predicts poor outcomes in patients with ovarian cancer and is a marker of proliferation. International Journal Of Oncology. 2020;56(1):219-231. 

Hwang, Yo Sep; Park, Eun Sun; Oh, Byung Moo; Uhm, Tae Gi; Yoon, Suk Ran; Park, Jong-Lyul; Cho, Hee Jun; Lee, Hee Gu. miR-302 Suppresses the Proliferation, Migration, and Invasion of Breast Cancer Cells by Downregulating ATAD2. Cancers. 2022;14(18)