Anti ATAD1 pAb (ATL-HPA037569)

Atlas Antibodies

Catalog No.:
ATL-HPA037569-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATPase family, AAA domain containing 1
Gene Name: ATAD1
Alternative Gene Name: FLJ14600
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000013662: 100%, ENSRNOG00000010861: 100%
Entrez Gene ID: 84896
Uniprot ID: Q8NBU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQ
Gene Sequence NVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQ
Gene ID - Mouse ENSMUSG00000013662
Gene ID - Rat ENSRNOG00000010861
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ATAD1 pAb (ATL-HPA037569)
Datasheet Anti ATAD1 pAb (ATL-HPA037569) Datasheet (External Link)
Vendor Page Anti ATAD1 pAb (ATL-HPA037569) at Atlas Antibodies

Documents & Links for Anti ATAD1 pAb (ATL-HPA037569)
Datasheet Anti ATAD1 pAb (ATL-HPA037569) Datasheet (External Link)
Vendor Page Anti ATAD1 pAb (ATL-HPA037569)