Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA020558-25

• 
• 

Protein Description: ankyrin repeat, SAM and basic leucine zipper domain containing 1
Gene Name: ASZ1
Alternative Gene Name: ALP1, ANKL1, C7orf7, CT1.19, GASZ, Orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010796: 90%, ENSRNOG00000060343: 90%
Entrez Gene ID: 136991
Uniprot ID: Q8WWH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED
• Gene Sequence: DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED
• Gene ID - Mouse: ENSMUSG00000010796
• Gene ID - Rat: ENSRNOG00000060343
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.