Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020558-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ASZ1
Alternative Gene Name: ALP1, ANKL1, C7orf7, CT1.19, GASZ, Orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010796: 90%, ENSRNOG00000060343: 90%
Entrez Gene ID: 136991
Uniprot ID: Q8WWH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED |
| Gene Sequence | DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED |
| Gene ID - Mouse | ENSMUSG00000010796 |
| Gene ID - Rat | ENSRNOG00000060343 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation) | |
| Datasheet | Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation) | |
| Datasheet | Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation) |