Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA020558-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat, SAM and basic leucine zipper domain containing 1
Gene Name: ASZ1
Alternative Gene Name: ALP1, ANKL1, C7orf7, CT1.19, GASZ, Orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010796: 90%, ENSRNOG00000060343: 90%
Entrez Gene ID: 136991
Uniprot ID: Q8WWH4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED
Gene Sequence DGHTQVVALLVAHGAEVNTQDENGYTALTWAARQGHKNIVLKLLELGANKMLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKED
Gene ID - Mouse ENSMUSG00000010796
Gene ID - Rat ENSRNOG00000060343
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation)
Datasheet Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation)
Datasheet Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASZ1 pAb (ATL-HPA020558 w/enhanced validation)