Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA020934-25

• 
• 
• 

Protein Description: argininosuccinate synthase 1
Gene Name: ASS1
Alternative Gene Name: ASS, CTLN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000076441: 95%, ENSRNOG00000008837: 97%
Entrez Gene ID: 445
Uniprot ID: P00966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDG
• Gene Sequence: AKQHGIPIPVTPKNPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKDG
• Gene ID - Mouse: ENSMUSG00000076441
• Gene ID - Rat: ENSRNOG00000008837
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ASS1 pAb (ATL-HPA020934 w/enhanced validation) – 2 Found

Locke, Matthew; Ghazaly, Essam; Freitas, Marta O; Mitsinga, Mikaella; Lattanzio, Laura; Lo Nigro, Cristiana; Nagano, Ai; Wang, Jun; Chelala, Claude; Szlosarek, Peter; Martin, Sarah A. Inhibition of the Polyamine Synthesis Pathway Is Synthetically Lethal with Loss of Argininosuccinate Synthase 1. Cell Reports. 2016;16(6):1604-1613. 

Ji, Jennifer X; Cochrane, Dawn R; Tessier-Cloutier, Basile; Chen, Shary Yutin; Ho, Germain; Pathak, Khyatiben V; Alcazar, Isabel N; Farnell, David; Leung, Samuel; Cheng, Angela; Chow, Christine; Colborne, Shane; Negri, Gian Luca; Kommoss, Friedrich; Karnezis, Anthony; Morin, Gregg B; McAlpine, Jessica N; Gilks, C Blake; Weissman, Bernard E; Trent, Jeffrey M; Hoang, Lynn; Pirrotte, Patrick; Wang, Yemin; Huntsman, David G. Arginine Depletion Therapy with ADI-PEG20 Limits Tumor Growth in Argininosuccinate Synthase-Deficient Ovarian Cancer, Including Small-Cell Carcinoma of the Ovary, Hypercalcemic Type. Clinical Cancer Research : An Official Journal Of The American Association For Cancer Research. 2020;26(16):4402-4413.