Anti ASPSCR1 pAb (ATL-HPA026749)

Atlas Antibodies

SKU: ATL-HPA026749-25

• 
• 
• 

Protein Description: alveolar soft part sarcoma chromosome region, candidate 1
Gene Name: ASPSCR1
Alternative Gene Name: ASPL, ASPS, UBXD9, UBXN9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025142: 61%, ENSRNOG00000036678: 55%
Entrez Gene ID: 79058
Uniprot ID: Q9BZE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSS
• Gene Sequence: GSSASAGQAAASAPLPLESGELSRGDLSRPEDADTSGPCCEHTQEKQSTRAPAAAPFVPFSGGGQRLGGPPGPTRPLTSSS
• Gene ID - Mouse: ENSMUSG00000025142
• Gene ID - Rat: ENSRNOG00000036678
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.