Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034810-25

Protein Description: aspartic peptidase, retroviral-like 1
Gene Name: ASPRV1
Alternative Gene Name: FLJ25084, SASPase, Taps
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033508: 86%, ENSRNOG00000012891: 25%
Entrez Gene ID: 151516
Uniprot ID: Q53RT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SHLPKEIVFANSMGKGYYLKGKIGKVPVRFLVDSGAQVSVVHPNLWEEVTDGDLDTLQPFENVVKVANGAEMKILGVWDTAVSL
• Gene Sequence: SHLPKEIVFANSMGKGYYLKGKIGKVPVRFLVDSGAQVSVVHPNLWEEVTDGDLDTLQPFENVVKVANGAEMKILGVWDTAVSL
• Gene ID - Mouse: ENSMUSG00000033508
• Gene ID - Rat: ENSRNOG00000012891
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.