Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA034810-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ASPRV1
Alternative Gene Name: FLJ25084, SASPase, Taps
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033508: 86%, ENSRNOG00000012891: 25%
Entrez Gene ID: 151516
Uniprot ID: Q53RT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SHLPKEIVFANSMGKGYYLKGKIGKVPVRFLVDSGAQVSVVHPNLWEEVTDGDLDTLQPFENVVKVANGAEMKILGVWDTAVSL |
| Gene Sequence | SHLPKEIVFANSMGKGYYLKGKIGKVPVRFLVDSGAQVSVVHPNLWEEVTDGDLDTLQPFENVVKVANGAEMKILGVWDTAVSL |
| Gene ID - Mouse | ENSMUSG00000033508 |
| Gene ID - Rat | ENSRNOG00000012891 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation) | |
| Datasheet | Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation) | |
| Datasheet | Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation) |