Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA034810-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: aspartic peptidase, retroviral-like 1
Gene Name: ASPRV1
Alternative Gene Name: FLJ25084, SASPase, Taps
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033508: 86%, ENSRNOG00000012891: 25%
Entrez Gene ID: 151516
Uniprot ID: Q53RT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SHLPKEIVFANSMGKGYYLKGKIGKVPVRFLVDSGAQVSVVHPNLWEEVTDGDLDTLQPFENVVKVANGAEMKILGVWDTAVSL
Gene Sequence SHLPKEIVFANSMGKGYYLKGKIGKVPVRFLVDSGAQVSVVHPNLWEEVTDGDLDTLQPFENVVKVANGAEMKILGVWDTAVSL
Gene ID - Mouse ENSMUSG00000033508
Gene ID - Rat ENSRNOG00000012891
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation)
Datasheet Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation)
Datasheet Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASPRV1 pAb (ATL-HPA034810 w/enhanced validation)