Anti ASPH pAb (ATL-HPA055161)

Atlas Antibodies

Catalog No.:
ATL-HPA055161-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: aspartate beta-hydroxylase
Gene Name: ASPH
Alternative Gene Name: BAH, CASQ2BP1, HAAH, JCTN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028207: 99%, ENSRNOG00000007445: 99%
Entrez Gene ID: 444
Uniprot ID: Q12797
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVWQRSLYNVNGLKAQPWWTPKETGYTELVKSLERNWKLIRDE
Gene Sequence ESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRVGNKEAYKWYELGHKRGHFASVWQRSLYNVNGLKAQPWWTPKETGYTELVKSLERNWKLIRDE
Gene ID - Mouse ENSMUSG00000028207
Gene ID - Rat ENSRNOG00000007445
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASPH pAb (ATL-HPA055161)
Datasheet Anti ASPH pAb (ATL-HPA055161) Datasheet (External Link)
Vendor Page Anti ASPH pAb (ATL-HPA055161) at Atlas Antibodies

Documents & Links for Anti ASPH pAb (ATL-HPA055161)
Datasheet Anti ASPH pAb (ATL-HPA055161) Datasheet (External Link)
Vendor Page Anti ASPH pAb (ATL-HPA055161)