Anti ASPG pAb (ATL-HPA069761 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA069761-100
  • Immunohistochemistry analysis in human kidney and pancreas tissues using Anti-ASPG antibody. Corresponding ASPG RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: asparaginase
Gene Name: ASPG
Alternative Gene Name: C14orf76
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037686: 80%, ENSRNOG00000012843: 80%
Entrez Gene ID: 374569
Uniprot ID: Q86U10
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLVPGTGLAAILRTLPMFHDEEHARARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTD
Gene Sequence VLVPGTGLAAILRTLPMFHDEEHARARGLSEDTLVLPPASRNQRILYTVLECQPLFDSSDMTIAEWVCLAQTIKRHYEQYHGFVVIHGTD
Gene ID - Mouse ENSMUSG00000037686
Gene ID - Rat ENSRNOG00000012843
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ASPG pAb (ATL-HPA069761 w/enhanced validation)
Datasheet Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ASPG pAb (ATL-HPA069761 w/enhanced validation)
Datasheet Anti ASPG pAb (ATL-HPA069761 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASPG pAb (ATL-HPA069761 w/enhanced validation)