Anti ASPDH pAb (ATL-HPA042654)

Atlas Antibodies

Catalog No.:
ATL-HPA042654-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aspartate dehydrogenase domain containing
Gene Name: ASPDH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038704: 88%, ENSRNOG00000019424: 90%
Entrez Gene ID: 554235
Uniprot ID: A6ND91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QTTERQLLEASQHWDHAVFVARGALWGAEDIRRLDAAGGLRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMA
Gene Sequence QTTERQLLEASQHWDHAVFVARGALWGAEDIRRLDAAGGLRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMA
Gene ID - Mouse ENSMUSG00000038704
Gene ID - Rat ENSRNOG00000019424
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASPDH pAb (ATL-HPA042654)
Datasheet Anti ASPDH pAb (ATL-HPA042654) Datasheet (External Link)
Vendor Page Anti ASPDH pAb (ATL-HPA042654) at Atlas Antibodies

Documents & Links for Anti ASPDH pAb (ATL-HPA042654)
Datasheet Anti ASPDH pAb (ATL-HPA042654) Datasheet (External Link)
Vendor Page Anti ASPDH pAb (ATL-HPA042654)