Anti ASPA pAb (ATL-HPA022142 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA022142-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: aspartoacylase
Gene Name: ASPA
Alternative Gene Name: ACY2, ASP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020774: 91%, ENSRNOG00000019659: 92%
Entrez Gene ID: 443
Uniprot ID: P45381
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAK
Gene Sequence AIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAK
Gene ID - Mouse ENSMUSG00000020774
Gene ID - Rat ENSRNOG00000019659
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASPA pAb (ATL-HPA022142 w/enhanced validation)
Datasheet Anti ASPA pAb (ATL-HPA022142 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASPA pAb (ATL-HPA022142 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ASPA pAb (ATL-HPA022142 w/enhanced validation)
Datasheet Anti ASPA pAb (ATL-HPA022142 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASPA pAb (ATL-HPA022142 w/enhanced validation)