Anti ASNSD1 pAb (ATL-HPA036133)

Atlas Antibodies

SKU:
ATL-HPA036133-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: asparagine synthetase domain containing 1
Gene Name: ASNSD1
Alternative Gene Name: FLJ20752, NBLA00058, NS3TP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000099913: 62%, ENSRNOG00000003942: 64%
Entrez Gene ID: 54529
Uniprot ID: Q9NWL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQWQEVPASGLFRIDLKSTVISRCIILQLYPWKYISRENIIEENVNSLSQISADLPAFVSVVANEAKLYLEKPVVPLNMMLPQAALETHCSNISNVP
Gene Sequence NQWQEVPASGLFRIDLKSTVISRCIILQLYPWKYISRENIIEENVNSLSQISADLPAFVSVVANEAKLYLEKPVVPLNMMLPQAALETHCSNISNVP
Gene ID - Mouse ENSMUSG00000099913
Gene ID - Rat ENSRNOG00000003942
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ASNSD1 pAb (ATL-HPA036133)
Datasheet Anti ASNSD1 pAb (ATL-HPA036133) Datasheet (External Link)
Vendor Page Anti ASNSD1 pAb (ATL-HPA036133) at Atlas Antibodies

Documents & Links for Anti ASNSD1 pAb (ATL-HPA036133)
Datasheet Anti ASNSD1 pAb (ATL-HPA036133) Datasheet (External Link)
Vendor Page Anti ASNSD1 pAb (ATL-HPA036133)