Anti ASNS pAb (ATL-HPA064737)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064737-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ASNS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029752: 96%, ENSRNOG00000007546: 96%
Entrez Gene ID: 440
Uniprot ID: P08243
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQ |
| Gene Sequence | MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQ |
| Gene ID - Mouse | ENSMUSG00000029752 |
| Gene ID - Rat | ENSRNOG00000007546 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASNS pAb (ATL-HPA064737) | |
| Datasheet | Anti ASNS pAb (ATL-HPA064737) Datasheet (External Link) |
| Vendor Page | Anti ASNS pAb (ATL-HPA064737) at Atlas Antibodies |
| Documents & Links for Anti ASNS pAb (ATL-HPA064737) | |
| Datasheet | Anti ASNS pAb (ATL-HPA064737) Datasheet (External Link) |
| Vendor Page | Anti ASNS pAb (ATL-HPA064737) |