Anti ASNS pAb (ATL-HPA064737)

Atlas Antibodies

Catalog No.:
ATL-HPA064737-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: asparagine synthetase (glutamine-hydrolyzing)
Gene Name: ASNS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029752: 96%, ENSRNOG00000007546: 96%
Entrez Gene ID: 440
Uniprot ID: P08243
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQ
Gene Sequence MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQ
Gene ID - Mouse ENSMUSG00000029752
Gene ID - Rat ENSRNOG00000007546
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASNS pAb (ATL-HPA064737)
Datasheet Anti ASNS pAb (ATL-HPA064737) Datasheet (External Link)
Vendor Page Anti ASNS pAb (ATL-HPA064737) at Atlas Antibodies

Documents & Links for Anti ASNS pAb (ATL-HPA064737)
Datasheet Anti ASNS pAb (ATL-HPA064737) Datasheet (External Link)
Vendor Page Anti ASNS pAb (ATL-HPA064737)