Anti ASNS pAb (ATL-HPA029318)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029318-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ASNS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029752: 94%, ENSRNOG00000007546: 93%
Entrez Gene ID: 440
Uniprot ID: P08243
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP |
Gene Sequence | QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP |
Gene ID - Mouse | ENSMUSG00000029752 |
Gene ID - Rat | ENSRNOG00000007546 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ASNS pAb (ATL-HPA029318) | |
Datasheet | Anti ASNS pAb (ATL-HPA029318) Datasheet (External Link) |
Vendor Page | Anti ASNS pAb (ATL-HPA029318) at Atlas Antibodies |
Documents & Links for Anti ASNS pAb (ATL-HPA029318) | |
Datasheet | Anti ASNS pAb (ATL-HPA029318) Datasheet (External Link) |
Vendor Page | Anti ASNS pAb (ATL-HPA029318) |
Citations for Anti ASNS pAb (ATL-HPA029318) – 8 Found |
Sullivan, Lucas B; Luengo, Alba; Danai, Laura V; Bush, Lauren N; Diehl, Frances F; Hosios, Aaron M; Lau, Allison N; Elmiligy, Sarah; Malstrom, Scott; Lewis, Caroline A; Vander Heiden, Matthew G. Aspartate is an endogenous metabolic limitation for tumour growth. Nature Cell Biology. 2018;20(7):782-788. PubMed |
Hope, Helen Carrasco; Brownlie, Rebecca J; Fife, Christopher M; Steele, Lynette; Lorger, Mihaela; Salmond, Robert J. Coordination of asparagine uptake and asparagine synthetase expression modulates CD8+ T cell activation. Jci Insight. 2021;6(9) PubMed |
Akahane, Koshi; Kimura, Shunsuke; Miyake, Kunio; Watanabe, Atsushi; Kagami, Keiko; Yoshimura, Kentaro; Shinohara, Tamao; Harama, Daisuke; Kasai, Shin; Goi, Kumiko; Kawai, Tomoko; Hata, Kenichiro; Kiyokawa, Nobutaka; Koh, Katsuyoshi; Imamura, Toshihiko; Horibe, Keizo; Look, A Thomas; Minegishi, Masayoshi; Sugita, Kanji; Takita, Junko; Inukai, Takeshi. Association of allele-specific methylation of the ASNS gene with asparaginase sensitivity and prognosis in T-ALL. Blood Advances. 2022;6(1):212-224. PubMed |
Hettmer, Simone; Schinzel, Anna C; Tchessalova, Daria; Schneider, Michaela; Parker, Christina L; Bronson, Roderick T; Richards, Nigel Gj; Hahn, William C; Wagers, Amy J. Functional genomic screening reveals asparagine dependence as a metabolic vulnerability in sarcoma. Elife. 2015;4( 26499495) PubMed |
Brown, David; Ryan, Kevin; Daniel, Zoe; Mareko, Molebeledi; Talbot, Richard; Moreton, Joanna; Giles, Tom C B; Emes, Richard; Hodgman, Charlie; Parr, Tim; Brameld, John M. The Beta-adrenergic agonist, Ractopamine, increases skeletal muscle expression of Asparagine Synthetase as part of an integrated stress response gene program. Scientific Reports. 2018;8(1):15915. PubMed |
Watanabe, Atsushi; Miyake, Kunio; Nordlund, Jessica; Syvänen, Ann-Christine; van der Weyden, Louise; Honda, Hiroaki; Yamasaki, Norimasa; Nagamachi, Akiko; Inaba, Toshiya; Ikawa, Tomokatsu; Urayama, Kevin Y; Kiyokawa, Nobutaka; Ohara, Akira; Kimura, Shunsuke; Kubota, Yasuo; Takita, Junko; Goto, Hiroaki; Sakaguchi, Kimiyoshi; Minegishi, Masayoshi; Iwamoto, Shotaro; Shinohara, Tamao; Kagami, Keiko; Abe, Masako; Akahane, Koshi; Goi, Kumiko; Sugita, Kanji; Inukai, Takeshi. Association of aberrant ASNS imprinting with asparaginase sensitivity and chromosomal abnormality in childhood BCP-ALL. Blood. 2020;136(20):2319-2333. PubMed |
Tajan, Mylène; Hennequart, Marc; Cheung, Eric C; Zani, Fabio; Hock, Andreas K; Legrave, Nathalie; Maddocks, Oliver D K; Ridgway, Rachel A; Athineos, Dimitris; Suárez-Bonnet, Alejandro; Ludwig, Robert L; Novellasdemunt, Laura; Angelis, Nikolaos; Li, Vivian S W; Vlachogiannis, Georgios; Valeri, Nicola; Mainolfi, Nello; Suri, Vipin; Friedman, Adam; Manfredi, Mark; Blyth, Karen; Sansom, Owen J; Vousden, Karen H. Serine synthesis pathway inhibition cooperates with dietary serine and glycine limitation for cancer therapy. Nature Communications. 2021;12(1):366. PubMed |
Fu, Yong; Ding, Liang; Yang, Xihu; Ding, Zhuang; Huang, Xiaofeng; Zhang, Lei; Chen, Sheng; Hu, Qingang; Ni, Yanhong. Asparagine Synthetase-Mediated l-Asparagine Metabolism Disorder Promotes the Perineural Invasion of Oral Squamous Cell Carcinoma. Frontiers In Oncology. 11( 33777794):637226. PubMed |