Anti ASNS pAb (ATL-HPA004924 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA004924-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ASNS
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029752: 94%, ENSRNOG00000007546: 93%
Entrez Gene ID: 440
Uniprot ID: P08243
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP |
Gene Sequence | QHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDVP |
Gene ID - Mouse | ENSMUSG00000029752 |
Gene ID - Rat | ENSRNOG00000007546 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ASNS pAb (ATL-HPA004924 w/enhanced validation) | |
Datasheet | Anti ASNS pAb (ATL-HPA004924 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ASNS pAb (ATL-HPA004924 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ASNS pAb (ATL-HPA004924 w/enhanced validation) | |
Datasheet | Anti ASNS pAb (ATL-HPA004924 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ASNS pAb (ATL-HPA004924 w/enhanced validation) |