Anti ASNA1 pAb (ATL-HPA048087)

Atlas Antibodies

SKU: ATL-HPA048087-25

• 

Protein Description: arsA arsenite transporter, ATP-binding, homolog 1 (bacterial)
Gene Name: ASNA1
Alternative Gene Name: ARSA-I, GET3, TRC40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052456: 100%, ENSRNOG00000003747: 100%
Entrez Gene ID: 439
Uniprot ID: O43681
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPS
• Gene Sequence: EPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPS
• Gene ID - Mouse: ENSMUSG00000052456
• Gene ID - Rat: ENSRNOG00000003747
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.