Anti ASNA1 pAb (ATL-HPA048087)
Atlas Antibodies
- SKU:
- ATL-HPA048087-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ASNA1
Alternative Gene Name: ARSA-I, GET3, TRC40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052456: 100%, ENSRNOG00000003747: 100%
Entrez Gene ID: 439
Uniprot ID: O43681
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPS |
Gene Sequence | EPTLSNIIEQRSLKWIFVGGKGGVGKTTCSCSLAVQLSKGRESVLIISTDPAHNISDAFDQKFSKVPTKVKGYDNLFAMEIDPS |
Gene ID - Mouse | ENSMUSG00000052456 |
Gene ID - Rat | ENSRNOG00000003747 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ASNA1 pAb (ATL-HPA048087) | |
Datasheet | Anti ASNA1 pAb (ATL-HPA048087) Datasheet (External Link) |
Vendor Page | Anti ASNA1 pAb (ATL-HPA048087) at Atlas Antibodies |
Documents & Links for Anti ASNA1 pAb (ATL-HPA048087) | |
Datasheet | Anti ASNA1 pAb (ATL-HPA048087) Datasheet (External Link) |
Vendor Page | Anti ASNA1 pAb (ATL-HPA048087) |