Anti ASL pAb (ATL-HPA016646 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016646-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ASL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025533: 92%, ENSRNOG00000000903: 86%
Entrez Gene ID: 435
Uniprot ID: P04424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDED |
| Gene Sequence | MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDED |
| Gene ID - Mouse | ENSMUSG00000025533 |
| Gene ID - Rat | ENSRNOG00000000903 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASL pAb (ATL-HPA016646 w/enhanced validation) | |
| Datasheet | Anti ASL pAb (ATL-HPA016646 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASL pAb (ATL-HPA016646 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ASL pAb (ATL-HPA016646 w/enhanced validation) | |
| Datasheet | Anti ASL pAb (ATL-HPA016646 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASL pAb (ATL-HPA016646 w/enhanced validation) |
| Citations for Anti ASL pAb (ATL-HPA016646 w/enhanced validation) – 4 Found |
| Locke, Matthew; Ghazaly, Essam; Freitas, Marta O; Mitsinga, Mikaella; Lattanzio, Laura; Lo Nigro, Cristiana; Nagano, Ai; Wang, Jun; Chelala, Claude; Szlosarek, Peter; Martin, Sarah A. Inhibition of the Polyamine Synthesis Pathway Is Synthetically Lethal with Loss of Argininosuccinate Synthase 1. Cell Reports. 2016;16(6):1604-1613. PubMed |
| Werner, Anke; Koschke, Miriam; Leuchtner, Nadine; Luckner-Minden, Claudia; Habermeier, Alice; Rupp, Johanna; Heinrich, Christin; Conradi, Roland; Closs, Ellen I; Munder, Markus. Reconstitution of T Cell Proliferation under Arginine Limitation: Activated Human T Cells Take Up Citrulline via L-Type Amino Acid Transporter 1 and Use It to Regenerate Arginine after Induction of Argininosuccinate Synthase Expression. Frontiers In Immunology. 8( 28791021):864. PubMed |
| Khare, Sanika; Kim, Laura C; Lobel, Graham; Doulias, Paschalis-Thomas; Ischiropoulos, Harry; Nissim, Itzhak; Keith, Brian; Simon, M Celeste. ASS1 and ASL suppress growth in clear cell renal cell carcinoma via altered nitrogen metabolism. Cancer & Metabolism. 2021;9(1):40. PubMed |
| van Straten, Giora; van Steenbeek, Frank G; Grinwis, Guy C M; Favier, Robert P; Kummeling, Anne; van Gils, Ingrid H; Fieten, Hille; Groot Koerkamp, Marian J A; Holstege, Frank C P; Rothuizen, Jan; Spee, Bart. Aberrant expression and distribution of enzymes of the urea cycle and other ammonia metabolizing pathways in dogs with congenital portosystemic shunts. Plos One. 9(6):e100077. PubMed |