Anti ASL pAb (ATL-HPA016646 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA016646-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: argininosuccinate lyase
Gene Name: ASL
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025533: 92%, ENSRNOG00000000903: 86%
Entrez Gene ID: 435
Uniprot ID: P04424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDED
Gene Sequence MASESGKLWGGRFVGAVDPIMEKFNASIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLNSNDED
Gene ID - Mouse ENSMUSG00000025533
Gene ID - Rat ENSRNOG00000000903
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASL pAb (ATL-HPA016646 w/enhanced validation)
Datasheet Anti ASL pAb (ATL-HPA016646 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASL pAb (ATL-HPA016646 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ASL pAb (ATL-HPA016646 w/enhanced validation)
Datasheet Anti ASL pAb (ATL-HPA016646 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASL pAb (ATL-HPA016646 w/enhanced validation)
Citations for Anti ASL pAb (ATL-HPA016646 w/enhanced validation) – 4 Found
Locke, Matthew; Ghazaly, Essam; Freitas, Marta O; Mitsinga, Mikaella; Lattanzio, Laura; Lo Nigro, Cristiana; Nagano, Ai; Wang, Jun; Chelala, Claude; Szlosarek, Peter; Martin, Sarah A. Inhibition of the Polyamine Synthesis Pathway Is Synthetically Lethal with Loss of Argininosuccinate Synthase 1. Cell Reports. 2016;16(6):1604-1613.  PubMed
Werner, Anke; Koschke, Miriam; Leuchtner, Nadine; Luckner-Minden, Claudia; Habermeier, Alice; Rupp, Johanna; Heinrich, Christin; Conradi, Roland; Closs, Ellen I; Munder, Markus. Reconstitution of T Cell Proliferation under Arginine Limitation: Activated Human T Cells Take Up Citrulline via L-Type Amino Acid Transporter 1 and Use It to Regenerate Arginine after Induction of Argininosuccinate Synthase Expression. Frontiers In Immunology. 8( 28791021):864.  PubMed
Khare, Sanika; Kim, Laura C; Lobel, Graham; Doulias, Paschalis-Thomas; Ischiropoulos, Harry; Nissim, Itzhak; Keith, Brian; Simon, M Celeste. ASS1 and ASL suppress growth in clear cell renal cell carcinoma via altered nitrogen metabolism. Cancer & Metabolism. 2021;9(1):40.  PubMed
van Straten, Giora; van Steenbeek, Frank G; Grinwis, Guy C M; Favier, Robert P; Kummeling, Anne; van Gils, Ingrid H; Fieten, Hille; Groot Koerkamp, Marian J A; Holstege, Frank C P; Rothuizen, Jan; Spee, Bart. Aberrant expression and distribution of enzymes of the urea cycle and other ammonia metabolizing pathways in dogs with congenital portosystemic shunts. Plos One. 9(6):e100077.  PubMed