Anti ASIC5 pAb (ATL-HPA014903)

Atlas Antibodies

Catalog No.: ATL-HPA014903-25

Protein Description: acid-sensing (proton-gated) ion channel family member 5
Gene Name: ASIC5
Alternative Gene Name: ACCN5, HINAC, INAC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028008: 76%, ENSRNOG00000011842: 78%
Entrez Gene ID: 51802
Uniprot ID: Q9NY37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKI
• Gene Sequence: AENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKI
• Gene ID - Mouse: ENSMUSG00000028008
• Gene ID - Rat: ENSRNOG00000011842
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.