Anti ASIC5 pAb (ATL-HPA014903)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014903-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ASIC5
Alternative Gene Name: ACCN5, HINAC, INAC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028008: 76%, ENSRNOG00000011842: 78%
Entrez Gene ID: 51802
Uniprot ID: Q9NY37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKI |
Gene Sequence | AENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKI |
Gene ID - Mouse | ENSMUSG00000028008 |
Gene ID - Rat | ENSRNOG00000011842 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ASIC5 pAb (ATL-HPA014903) | |
Datasheet | Anti ASIC5 pAb (ATL-HPA014903) Datasheet (External Link) |
Vendor Page | Anti ASIC5 pAb (ATL-HPA014903) at Atlas Antibodies |
Documents & Links for Anti ASIC5 pAb (ATL-HPA014903) | |
Datasheet | Anti ASIC5 pAb (ATL-HPA014903) Datasheet (External Link) |
Vendor Page | Anti ASIC5 pAb (ATL-HPA014903) |