Anti ASIC5 pAb (ATL-HPA014903)

Atlas Antibodies

Catalog No.:
ATL-HPA014903-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: acid-sensing (proton-gated) ion channel family member 5
Gene Name: ASIC5
Alternative Gene Name: ACCN5, HINAC, INAC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028008: 76%, ENSRNOG00000011842: 78%
Entrez Gene ID: 51802
Uniprot ID: Q9NY37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKI
Gene Sequence AENGLLEKIKLCLSKKPLPSPTERKKFDHDFAISTSFHGIHNIVQNRSKI
Gene ID - Mouse ENSMUSG00000028008
Gene ID - Rat ENSRNOG00000011842
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASIC5 pAb (ATL-HPA014903)
Datasheet Anti ASIC5 pAb (ATL-HPA014903) Datasheet (External Link)
Vendor Page Anti ASIC5 pAb (ATL-HPA014903) at Atlas Antibodies

Documents & Links for Anti ASIC5 pAb (ATL-HPA014903)
Datasheet Anti ASIC5 pAb (ATL-HPA014903) Datasheet (External Link)
Vendor Page Anti ASIC5 pAb (ATL-HPA014903)