Anti ASIC4 pAb (ATL-HPA057078)

Atlas Antibodies

Catalog No.:
ATL-HPA057078-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: acid sensing ion channel subunit family member 4
Gene Name: ASIC4
Alternative Gene Name: ACCN4, BNAC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033007: 66%, ENSRNOG00000019985: 66%
Entrez Gene ID: 55515
Uniprot ID: Q96FT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLLAREGQGREALASPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLH
Gene Sequence GLLAREGQGREALASPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLH
Gene ID - Mouse ENSMUSG00000033007
Gene ID - Rat ENSRNOG00000019985
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASIC4 pAb (ATL-HPA057078)
Datasheet Anti ASIC4 pAb (ATL-HPA057078) Datasheet (External Link)
Vendor Page Anti ASIC4 pAb (ATL-HPA057078) at Atlas Antibodies

Documents & Links for Anti ASIC4 pAb (ATL-HPA057078)
Datasheet Anti ASIC4 pAb (ATL-HPA057078) Datasheet (External Link)
Vendor Page Anti ASIC4 pAb (ATL-HPA057078)