Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052112-25

• 
• 

Protein Description: acid-sensing (proton-gated) ion channel 2
Gene Name: ASIC2
Alternative Gene Name: ACCN, ACCN1, ASIC2a, BNaC1, BNC1, hBNaC1, MDEG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020704: 99%, ENSRNOG00000059765: 51%
Entrez Gene ID: 40
Uniprot ID: Q16515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLDVNLQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKY
• Gene Sequence: LLDVNLQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKY
• Gene ID - Mouse: ENSMUSG00000020704
• Gene ID - Rat: ENSRNOG00000059765
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.