Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA052112-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ASIC2
Alternative Gene Name: ACCN, ACCN1, ASIC2a, BNaC1, BNC1, hBNaC1, MDEG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020704: 99%, ENSRNOG00000059765: 51%
Entrez Gene ID: 40
Uniprot ID: Q16515
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLDVNLQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKY |
Gene Sequence | LLDVNLQIPDPHLADPSVLEALRQKANFKHYKPKQFSMLEFLHRVGHDLKDMMLYCKFKGQECGHQDFTTVFTKY |
Gene ID - Mouse | ENSMUSG00000020704 |
Gene ID - Rat | ENSRNOG00000059765 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) | |
Datasheet | Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) | |
Datasheet | Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ASIC2 pAb (ATL-HPA052112 w/enhanced validation) |