Anti ASIC1 pAb (ATL-HPA058870)

Atlas Antibodies

Catalog No.:
ATL-HPA058870-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: acid sensing (proton gated) ion channel 1
Gene Name: ASIC1
Alternative Gene Name: ACCN2, BNaC2, hBNaC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023017: 99%, ENSRNOG00000059765: 99%
Entrez Gene ID: 41
Uniprot ID: P78348
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFT
Gene Sequence LALLNNRYEIPDTQMADEKQLEILQDKANFRSFKPKPFNMREFYDRAGHDIRDMLLSCHFRGEVCSAEDFKVVFT
Gene ID - Mouse ENSMUSG00000023017
Gene ID - Rat ENSRNOG00000059765
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASIC1 pAb (ATL-HPA058870)
Datasheet Anti ASIC1 pAb (ATL-HPA058870) Datasheet (External Link)
Vendor Page Anti ASIC1 pAb (ATL-HPA058870) at Atlas Antibodies

Documents & Links for Anti ASIC1 pAb (ATL-HPA058870)
Datasheet Anti ASIC1 pAb (ATL-HPA058870) Datasheet (External Link)
Vendor Page Anti ASIC1 pAb (ATL-HPA058870)
Citations for Anti ASIC1 pAb (ATL-HPA058870) – 1 Found
Zhang, Xiao-Hua; Šarić, Tomo; Mehrjardi, Narges Zare; Hamad, Sarkawt; Morad, Martin. Acid-Sensitive Ion Channels Are Expressed in Human Induced Pluripotent Stem Cell-Derived Cardiomyocytes. Stem Cells And Development. 2019;28(14):920-932.  PubMed