Anti ASH2L pAb (ATL-HPA042289 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA042289-25
  • Immunohistochemical staining of human tonsil shows nuclear positivity in non-germinal center.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ASH2L antibody. Remaining relative intensity is presented.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ash2 (absent, small, or homeotic)-like (Drosophila)
Gene Name: ASH2L
Alternative Gene Name: ASH2, ASH2L1, ASH2L2, Bre2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031575: 100%, ENSRNOG00000014875: 100%
Entrez Gene ID: 9070
Uniprot ID: Q9UBL3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEM
Gene Sequence TTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEM
Gene ID - Mouse ENSMUSG00000031575
Gene ID - Rat ENSRNOG00000014875
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ASH2L pAb (ATL-HPA042289 w/enhanced validation)
Datasheet Anti ASH2L pAb (ATL-HPA042289 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASH2L pAb (ATL-HPA042289 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ASH2L pAb (ATL-HPA042289 w/enhanced validation)
Datasheet Anti ASH2L pAb (ATL-HPA042289 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASH2L pAb (ATL-HPA042289 w/enhanced validation)