Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA015998-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: asialoglycoprotein receptor 2
Gene Name: ASGR2
Alternative Gene Name: CLEC4H2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040963: 73%, ENSRNOG00000030726: 69%
Entrez Gene ID: 433
Uniprot ID: P07307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR
Gene Sequence YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR
Gene ID - Mouse ENSMUSG00000040963
Gene ID - Rat ENSRNOG00000030726
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation)
Datasheet Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation)
Datasheet Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation)
Citations for Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) – 1 Found
Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17.  PubMed