Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA015998-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ASGR2
Alternative Gene Name: CLEC4H2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040963: 73%, ENSRNOG00000030726: 69%
Entrez Gene ID: 433
Uniprot ID: P07307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR |
Gene Sequence | YRHNYKNWAVTQPDNWHGHELGGSEDCVEVQPDGRWNDDFCLQVYRWVCEKR |
Gene ID - Mouse | ENSMUSG00000040963 |
Gene ID - Rat | ENSRNOG00000030726 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) | |
Datasheet | Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) | |
Datasheet | Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) |
Citations for Anti ASGR2 pAb (ATL-HPA015998 w/enhanced validation) – 1 Found |
Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. PubMed |