Anti ASGR2 pAb (ATL-HPA014899 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA014899-25
  • Immunohistochemistry analysis in human liver and pancreas tissues using Anti-ASGR2 antibody. Corresponding ASGR2 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line HepG2.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: asialoglycoprotein receptor 2
Gene Name: ASGR2
Alternative Gene Name: CLEC4H2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040963: 60%, ENSRNOG00000030726: 56%
Entrez Gene ID: 433
Uniprot ID: P07307
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QSAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCC
Gene Sequence QSAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVACQMELLHSNGSQRTCC
Gene ID - Mouse ENSMUSG00000040963
Gene ID - Rat ENSRNOG00000030726
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ASGR2 pAb (ATL-HPA014899 w/enhanced validation)
Datasheet Anti ASGR2 pAb (ATL-HPA014899 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASGR2 pAb (ATL-HPA014899 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ASGR2 pAb (ATL-HPA014899 w/enhanced validation)
Datasheet Anti ASGR2 pAb (ATL-HPA014899 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASGR2 pAb (ATL-HPA014899 w/enhanced validation)