Anti ASGR1 pAb (ATL-HPA011954 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011954-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ASGR1
Alternative Gene Name: CLEC4H1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020884: 76%, ENSRNOG00000018693: 76%
Entrez Gene ID: 432
Uniprot ID: P07306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRL |
| Gene Sequence | MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRL |
| Gene ID - Mouse | ENSMUSG00000020884 |
| Gene ID - Rat | ENSRNOG00000018693 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASGR1 pAb (ATL-HPA011954 w/enhanced validation) | |
| Datasheet | Anti ASGR1 pAb (ATL-HPA011954 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASGR1 pAb (ATL-HPA011954 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ASGR1 pAb (ATL-HPA011954 w/enhanced validation) | |
| Datasheet | Anti ASGR1 pAb (ATL-HPA011954 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ASGR1 pAb (ATL-HPA011954 w/enhanced validation) |
| Citations for Anti ASGR1 pAb (ATL-HPA011954 w/enhanced validation) – 1 Found |
| Shi, Bin; Abrams, Marc; Sepp-Lorenzino, Laura. Expression of asialoglycoprotein receptor 1 in human hepatocellular carcinoma. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(12):901-9. PubMed |