Anti ASGR1 pAb (ATL-HPA011954 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA011954-25

Protein Description: asialoglycoprotein receptor 1
Gene Name: ASGR1
Alternative Gene Name: CLEC4H1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020884: 76%, ENSRNOG00000018693: 76%
Entrez Gene ID: 432
Uniprot ID: P07306
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRL
• Gene Sequence: MTKEYQDLQHLDNEESDHHQLRKGPPPPQPLLQRLCSGPRL
• Gene ID - Mouse: ENSMUSG00000020884
• Gene ID - Rat: ENSRNOG00000018693
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ASGR1 pAb (ATL-HPA011954 w/enhanced validation) – 1 Found

Shi, Bin; Abrams, Marc; Sepp-Lorenzino, Laura. Expression of asialoglycoprotein receptor 1 in human hepatocellular carcinoma. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(12):901-9.