Anti ASCL4 pAb (ATL-HPA036116)

Atlas Antibodies

SKU: ATL-HPA036116-25

• 

Protein Description: achaete-scute family bHLH transcription factor 4
Gene Name: ASCL4
Alternative Gene Name: bHLHa44, HASH4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000085111: 48%, ENSRNOG00000031493: 40%
Entrez Gene ID: 121549
Uniprot ID: Q6XD76
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFEPAF
• Gene Sequence: METRKPAERLALPYSLRTAPLGVPGTLPGLPRRDPLRVALRLDAACWEWARSGCARGWQYLPVPLDSAFEPAF
• Gene ID - Mouse: ENSMUSG00000085111
• Gene ID - Rat: ENSRNOG00000031493
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.