Anti ASCL1 pAb (ATL-HPA076307)

Atlas Antibodies

Catalog No.: ATL-HPA076307-25

Protein Description: achaete-scute family bHLH transcription factor 1
Gene Name: ASCL1
Alternative Gene Name: ASH1, bHLHa46, HASH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020052: 97%, ENSRNOG00000004294: 97%
Entrez Gene ID: 429
Uniprot ID: P50553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSL
• Gene Sequence: GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSL
• Gene ID - Mouse: ENSMUSG00000020052
• Gene ID - Rat: ENSRNOG00000004294
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.