Anti ASCL1 pAb (ATL-HPA076307)

Atlas Antibodies

Catalog No.:
ATL-HPA076307-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: achaete-scute family bHLH transcription factor 1
Gene Name: ASCL1
Alternative Gene Name: ASH1, bHLHa46, HASH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020052: 97%, ENSRNOG00000004294: 97%
Entrez Gene ID: 429
Uniprot ID: P50553
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSL
Gene Sequence GGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSL
Gene ID - Mouse ENSMUSG00000020052
Gene ID - Rat ENSRNOG00000004294
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASCL1 pAb (ATL-HPA076307)
Datasheet Anti ASCL1 pAb (ATL-HPA076307) Datasheet (External Link)
Vendor Page Anti ASCL1 pAb (ATL-HPA076307) at Atlas Antibodies

Documents & Links for Anti ASCL1 pAb (ATL-HPA076307)
Datasheet Anti ASCL1 pAb (ATL-HPA076307) Datasheet (External Link)
Vendor Page Anti ASCL1 pAb (ATL-HPA076307)