Anti ASCC3 pAb (ATL-HPA031610 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA031610-25
  • Immunohistochemical staining of human cerebral cortex, colon, lymph node and testis using Anti-ASCC3 antibody HPA031610 (A) shows similar protein distribution across tissues to independent antibody HPA031608 (B).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: activating signal cointegrator 1 complex subunit 3
Gene Name: ASCC3
Alternative Gene Name: ASC1p200, dJ121G13.4, dJ467N11.1, HELIC1, RNAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038774: 84%, ENSRNOG00000037604: 86%
Entrez Gene ID: 10973
Uniprot ID: Q8N3C0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLNNMDEVCYENVLKQVKAGHQVMVFVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFSIHHAG
Gene Sequence QLNNMDEVCYENVLKQVKAGHQVMVFVHARNATVRTAMSLIERAKNCGHIPFFFPTQGHDYVLAEKQVQRSRNKQVRELFPDGFSIHHAG
Gene ID - Mouse ENSMUSG00000038774
Gene ID - Rat ENSRNOG00000037604
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ASCC3 pAb (ATL-HPA031610 w/enhanced validation)
Datasheet Anti ASCC3 pAb (ATL-HPA031610 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASCC3 pAb (ATL-HPA031610 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ASCC3 pAb (ATL-HPA031610 w/enhanced validation)
Datasheet Anti ASCC3 pAb (ATL-HPA031610 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASCC3 pAb (ATL-HPA031610 w/enhanced validation)