Anti ASB7 pAb (ATL-HPA003300 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA003300-25
  • Immunohistochemistry analysis in human testis and pancreas tissues using Anti-ASB7 antibody. Corresponding ASB7 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol & the Golgi apparatus.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and aSB7 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411164).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and SOCS box containing 7
Gene Name: ASB7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030509: 100%, ENSRNOG00000013795: 100%
Entrez Gene ID: 140460
Uniprot ID: Q9H672
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDK
Gene Sequence HHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDK
Gene ID - Mouse ENSMUSG00000030509
Gene ID - Rat ENSRNOG00000013795
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ASB7 pAb (ATL-HPA003300 w/enhanced validation)
Datasheet Anti ASB7 pAb (ATL-HPA003300 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASB7 pAb (ATL-HPA003300 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ASB7 pAb (ATL-HPA003300 w/enhanced validation)
Datasheet Anti ASB7 pAb (ATL-HPA003300 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASB7 pAb (ATL-HPA003300 w/enhanced validation)