Anti ASB6 pAb (ATL-HPA004341)

Atlas Antibodies

SKU:
ATL-HPA004341-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
  • Western blot analysis in human cell line SH-SY5Y.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and SOCS box containing 6
Gene Name: ASB6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039483: 88%, ENSRNOG00000024786: 43%
Entrez Gene ID: 140459
Uniprot ID: Q9NWX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRD
Gene Sequence IIFEYQPLVDAILGSLGIQDPERQESLDRPSYVASEESRILVLTELLERKAHSPFYQEGVSNALLKMAELGLTRAADVLLRHGANLNFEDPVTYYTALHIAVLRNQPDMVELLVHHGADVNRRD
Gene ID - Mouse ENSMUSG00000039483
Gene ID - Rat ENSRNOG00000024786
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ASB6 pAb (ATL-HPA004341)
Datasheet Anti ASB6 pAb (ATL-HPA004341) Datasheet (External Link)
Vendor Page Anti ASB6 pAb (ATL-HPA004341) at Atlas Antibodies

Documents & Links for Anti ASB6 pAb (ATL-HPA004341)
Datasheet Anti ASB6 pAb (ATL-HPA004341) Datasheet (External Link)
Vendor Page Anti ASB6 pAb (ATL-HPA004341)