Anti ASB3 pAb (ATL-HPA003940)

Atlas Antibodies

SKU:
ATL-HPA003940-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and SOCS box containing 3
Gene Name: ASB3
Alternative Gene Name: ASB-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020305: 89%, ENSRNOG00000032471: 90%
Entrez Gene ID: 51130
Uniprot ID: Q9Y575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQALDKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNKV
Gene Sequence LHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQALDKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNKV
Gene ID - Mouse ENSMUSG00000020305
Gene ID - Rat ENSRNOG00000032471
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ASB3 pAb (ATL-HPA003940)
Datasheet Anti ASB3 pAb (ATL-HPA003940) Datasheet (External Link)
Vendor Page Anti ASB3 pAb (ATL-HPA003940) at Atlas Antibodies

Documents & Links for Anti ASB3 pAb (ATL-HPA003940)
Datasheet Anti ASB3 pAb (ATL-HPA003940) Datasheet (External Link)
Vendor Page Anti ASB3 pAb (ATL-HPA003940)