Anti ASB3 pAb (ATL-HPA003940)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003940-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ASB3
Alternative Gene Name: ASB-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020305: 89%, ENSRNOG00000032471: 90%
Entrez Gene ID: 51130
Uniprot ID: Q9Y575
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQALDKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNKV |
| Gene Sequence | LHQASFQENAEIIKLLLRKGANKECQDDFGITPLFVAAQYGKLESLSILISSGANVNCQALDKATPLFIAAQEGHTKCVELLLSSGADPDLYCNEDSWQLPIHAAAQMGHTKILDLLIPLTNRACDTGLNKV |
| Gene ID - Mouse | ENSMUSG00000020305 |
| Gene ID - Rat | ENSRNOG00000032471 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASB3 pAb (ATL-HPA003940) | |
| Datasheet | Anti ASB3 pAb (ATL-HPA003940) Datasheet (External Link) |
| Vendor Page | Anti ASB3 pAb (ATL-HPA003940) at Atlas Antibodies |
| Documents & Links for Anti ASB3 pAb (ATL-HPA003940) | |
| Datasheet | Anti ASB3 pAb (ATL-HPA003940) Datasheet (External Link) |
| Vendor Page | Anti ASB3 pAb (ATL-HPA003940) |