Anti ASB16 pAb (ATL-HPA066834)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066834-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ASB16
Alternative Gene Name: FLJ30165
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034768: 91%, ENSRNOG00000036794: 87%
Entrez Gene ID: 92591
Uniprot ID: Q96NS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LLLRYGARAEVPNGAGHTPMDCALQAVQDSPNWEPEVLFAALLDYGAQPVRPEMLKHCANFPRALEVLLNAYPCV |
Gene Sequence | LLLRYGARAEVPNGAGHTPMDCALQAVQDSPNWEPEVLFAALLDYGAQPVRPEMLKHCANFPRALEVLLNAYPCV |
Gene ID - Mouse | ENSMUSG00000034768 |
Gene ID - Rat | ENSRNOG00000036794 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ASB16 pAb (ATL-HPA066834) | |
Datasheet | Anti ASB16 pAb (ATL-HPA066834) Datasheet (External Link) |
Vendor Page | Anti ASB16 pAb (ATL-HPA066834) at Atlas Antibodies |
Documents & Links for Anti ASB16 pAb (ATL-HPA066834) | |
Datasheet | Anti ASB16 pAb (ATL-HPA066834) Datasheet (External Link) |
Vendor Page | Anti ASB16 pAb (ATL-HPA066834) |