Anti ASB16 pAb (ATL-HPA066834)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066834-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ASB16
Alternative Gene Name: FLJ30165
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034768: 91%, ENSRNOG00000036794: 87%
Entrez Gene ID: 92591
Uniprot ID: Q96NS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LLLRYGARAEVPNGAGHTPMDCALQAVQDSPNWEPEVLFAALLDYGAQPVRPEMLKHCANFPRALEVLLNAYPCV |
| Gene Sequence | LLLRYGARAEVPNGAGHTPMDCALQAVQDSPNWEPEVLFAALLDYGAQPVRPEMLKHCANFPRALEVLLNAYPCV |
| Gene ID - Mouse | ENSMUSG00000034768 |
| Gene ID - Rat | ENSRNOG00000036794 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASB16 pAb (ATL-HPA066834) | |
| Datasheet | Anti ASB16 pAb (ATL-HPA066834) Datasheet (External Link) |
| Vendor Page | Anti ASB16 pAb (ATL-HPA066834) at Atlas Antibodies |
| Documents & Links for Anti ASB16 pAb (ATL-HPA066834) | |
| Datasheet | Anti ASB16 pAb (ATL-HPA066834) Datasheet (External Link) |
| Vendor Page | Anti ASB16 pAb (ATL-HPA066834) |