Anti ASB12 pAb (ATL-HPA049542)

Atlas Antibodies

SKU:
ATL-HPA049542-25
  • Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and SOCS box containing 12
Gene Name: ASB12
Alternative Gene Name: FLJ39577
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031204: 87%, ENSRNOG00000004197: 87%
Entrez Gene ID: 142689
Uniprot ID: Q8WXK4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLMDITKIFSLLQPDKEEEDTDTEEKQALNQAVYDNDSYTLDQLLRQERYKRFINSRSGWGVPGTPLRLAASYGHLSCLQVLL
Gene Sequence NLMDITKIFSLLQPDKEEEDTDTEEKQALNQAVYDNDSYTLDQLLRQERYKRFINSRSGWGVPGTPLRLAASYGHLSCLQVLL
Gene ID - Mouse ENSMUSG00000031204
Gene ID - Rat ENSRNOG00000004197
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ASB12 pAb (ATL-HPA049542)
Datasheet Anti ASB12 pAb (ATL-HPA049542) Datasheet (External Link)
Vendor Page Anti ASB12 pAb (ATL-HPA049542) at Atlas Antibodies

Documents & Links for Anti ASB12 pAb (ATL-HPA049542)
Datasheet Anti ASB12 pAb (ATL-HPA049542) Datasheet (External Link)
Vendor Page Anti ASB12 pAb (ATL-HPA049542)