Anti ASAP3 pAb (ATL-HPA020546)

Atlas Antibodies

Catalog No.:
ATL-HPA020546-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 3
Gene Name: ASAP3
Alternative Gene Name: CENTB6, DDEFL1, FLJ20199, UPLC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036995: 70%, ENSRNOG00000049714: 66%
Entrez Gene ID: 55616
Uniprot ID: Q8TDY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCAR
Gene Sequence KKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCAR
Gene ID - Mouse ENSMUSG00000036995
Gene ID - Rat ENSRNOG00000049714
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ASAP3 pAb (ATL-HPA020546)
Datasheet Anti ASAP3 pAb (ATL-HPA020546) Datasheet (External Link)
Vendor Page Anti ASAP3 pAb (ATL-HPA020546) at Atlas Antibodies

Documents & Links for Anti ASAP3 pAb (ATL-HPA020546)
Datasheet Anti ASAP3 pAb (ATL-HPA020546) Datasheet (External Link)
Vendor Page Anti ASAP3 pAb (ATL-HPA020546)