Anti ASAP3 pAb (ATL-HPA020546)
Atlas Antibodies
- Catalog No.:
- ATL-HPA020546-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ASAP3
Alternative Gene Name: CENTB6, DDEFL1, FLJ20199, UPLC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036995: 70%, ENSRNOG00000049714: 66%
Entrez Gene ID: 55616
Uniprot ID: Q8TDY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCAR |
| Gene Sequence | KKHHKECEELLEQAQAGTFAFPLHVDYSWVISTEPGSDSEEDEEEKRCLLKLPAQAHWASGRLDISNKTYETVASLGAATPQGESEDCPPPLPVKNSSRTLVQGCAR |
| Gene ID - Mouse | ENSMUSG00000036995 |
| Gene ID - Rat | ENSRNOG00000049714 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASAP3 pAb (ATL-HPA020546) | |
| Datasheet | Anti ASAP3 pAb (ATL-HPA020546) Datasheet (External Link) |
| Vendor Page | Anti ASAP3 pAb (ATL-HPA020546) at Atlas Antibodies |
| Documents & Links for Anti ASAP3 pAb (ATL-HPA020546) | |
| Datasheet | Anti ASAP3 pAb (ATL-HPA020546) Datasheet (External Link) |
| Vendor Page | Anti ASAP3 pAb (ATL-HPA020546) |