Anti ARV1 pAb (ATL-HPA035709)

Atlas Antibodies

Catalog No.:
ATL-HPA035709-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ARV1 homolog (S. cerevisiae)
Gene Name: ARV1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031982: 91%, ENSRNOG00000018909: 92%
Entrez Gene ID: 64801
Uniprot ID: Q9H2C2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVDKYIEYDPVIILINAILCKAQAYRHILFNTQINIHGKLCIFCLLCEAYLRWWQLQDSNQNTAPDDLIRYAKEW
Gene Sequence PVDKYIEYDPVIILINAILCKAQAYRHILFNTQINIHGKLCIFCLLCEAYLRWWQLQDSNQNTAPDDLIRYAKEW
Gene ID - Mouse ENSMUSG00000031982
Gene ID - Rat ENSRNOG00000018909
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARV1 pAb (ATL-HPA035709)
Datasheet Anti ARV1 pAb (ATL-HPA035709) Datasheet (External Link)
Vendor Page Anti ARV1 pAb (ATL-HPA035709) at Atlas Antibodies

Documents & Links for Anti ARV1 pAb (ATL-HPA035709)
Datasheet Anti ARV1 pAb (ATL-HPA035709) Datasheet (External Link)
Vendor Page Anti ARV1 pAb (ATL-HPA035709)