Anti ART5 pAb (ATL-HPA044099)
Atlas Antibodies
- SKU:
- ATL-HPA044099-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ART5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070424: 87%, ENSRNOG00000020242: 83%
Entrez Gene ID: 116969
Uniprot ID: Q96L15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSV |
Gene Sequence | LQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSV |
Gene ID - Mouse | ENSMUSG00000070424 |
Gene ID - Rat | ENSRNOG00000020242 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ART5 pAb (ATL-HPA044099) | |
Datasheet | Anti ART5 pAb (ATL-HPA044099) Datasheet (External Link) |
Vendor Page | Anti ART5 pAb (ATL-HPA044099) at Atlas Antibodies |
Documents & Links for Anti ART5 pAb (ATL-HPA044099) | |
Datasheet | Anti ART5 pAb (ATL-HPA044099) Datasheet (External Link) |
Vendor Page | Anti ART5 pAb (ATL-HPA044099) |