Anti ART5 pAb (ATL-HPA044099)

Atlas Antibodies

Catalog No.:
ATL-HPA044099-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ADP-ribosyltransferase 5
Gene Name: ART5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070424: 87%, ENSRNOG00000020242: 83%
Entrez Gene ID: 116969
Uniprot ID: Q96L15
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSV
Gene Sequence LQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSV
Gene ID - Mouse ENSMUSG00000070424
Gene ID - Rat ENSRNOG00000020242
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ART5 pAb (ATL-HPA044099)
Datasheet Anti ART5 pAb (ATL-HPA044099) Datasheet (External Link)
Vendor Page Anti ART5 pAb (ATL-HPA044099) at Atlas Antibodies

Documents & Links for Anti ART5 pAb (ATL-HPA044099)
Datasheet Anti ART5 pAb (ATL-HPA044099) Datasheet (External Link)
Vendor Page Anti ART5 pAb (ATL-HPA044099)