Anti ART1 pAb (ATL-HPA051148)

Atlas Antibodies

Catalog No.:
ATL-HPA051148-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ADP-ribosyltransferase 1
Gene Name: ART1
Alternative Gene Name: ART2, CD296
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030996: 72%, ENSRNOG00000020251: 71%
Entrez Gene ID: 417
Uniprot ID: P52961
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IQLDMALASFDDQYAGCAAAMTAALPDLNHTEFQANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLAYT
Gene Sequence IQLDMALASFDDQYAGCAAAMTAALPDLNHTEFQANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLAYT
Gene ID - Mouse ENSMUSG00000030996
Gene ID - Rat ENSRNOG00000020251
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ART1 pAb (ATL-HPA051148)
Datasheet Anti ART1 pAb (ATL-HPA051148) Datasheet (External Link)
Vendor Page Anti ART1 pAb (ATL-HPA051148) at Atlas Antibodies

Documents & Links for Anti ART1 pAb (ATL-HPA051148)
Datasheet Anti ART1 pAb (ATL-HPA051148) Datasheet (External Link)
Vendor Page Anti ART1 pAb (ATL-HPA051148)