Anti ARSJ pAb (ATL-HPA036482)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036482-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ARSJ
Alternative Gene Name: FLJ23548
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046561: 94%, ENSRNOG00000026060: 55%
Entrez Gene ID: 79642
Uniprot ID: Q5FYB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DSPGMCGYDLYENDNAAWDYDNGIYSTQMYTQRVQQILASHNPTKPIFLYIAYQAVHSPLQAPGRYFEHYRSIININRRRYAAMLSCLDEAINNV |
| Gene Sequence | DSPGMCGYDLYENDNAAWDYDNGIYSTQMYTQRVQQILASHNPTKPIFLYIAYQAVHSPLQAPGRYFEHYRSIININRRRYAAMLSCLDEAINNV |
| Gene ID - Mouse | ENSMUSG00000046561 |
| Gene ID - Rat | ENSRNOG00000026060 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARSJ pAb (ATL-HPA036482) | |
| Datasheet | Anti ARSJ pAb (ATL-HPA036482) Datasheet (External Link) |
| Vendor Page | Anti ARSJ pAb (ATL-HPA036482) at Atlas Antibodies |
| Documents & Links for Anti ARSJ pAb (ATL-HPA036482) | |
| Datasheet | Anti ARSJ pAb (ATL-HPA036482) Datasheet (External Link) |
| Vendor Page | Anti ARSJ pAb (ATL-HPA036482) |