Anti ARSJ pAb (ATL-HPA036481)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036481-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ARSJ
Alternative Gene Name: FLJ23548
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046561: 97%, ENSRNOG00000026060: 52%
Entrez Gene ID: 79642
Uniprot ID: Q5FYB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK |
Gene Sequence | TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK |
Gene ID - Mouse | ENSMUSG00000046561 |
Gene ID - Rat | ENSRNOG00000026060 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARSJ pAb (ATL-HPA036481) | |
Datasheet | Anti ARSJ pAb (ATL-HPA036481) Datasheet (External Link) |
Vendor Page | Anti ARSJ pAb (ATL-HPA036481) at Atlas Antibodies |
Documents & Links for Anti ARSJ pAb (ATL-HPA036481) | |
Datasheet | Anti ARSJ pAb (ATL-HPA036481) Datasheet (External Link) |
Vendor Page | Anti ARSJ pAb (ATL-HPA036481) |