Anti ARSJ pAb (ATL-HPA036481)

Atlas Antibodies

SKU: ATL-HPA036481-100

• 
• 
• 

Protein Description: arylsulfatase family, member J
Gene Name: ARSJ
Alternative Gene Name: FLJ23548
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046561: 97%, ENSRNOG00000026060: 52%
Entrez Gene ID: 79642
Uniprot ID: Q5FYB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK
• Gene Sequence: TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK
• Gene ID - Mouse: ENSMUSG00000046561
• Gene ID - Rat: ENSRNOG00000026060
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.