Anti ARSJ pAb (ATL-HPA036481)

Atlas Antibodies

Catalog No.:
ATL-HPA036481-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: arylsulfatase family, member J
Gene Name: ARSJ
Alternative Gene Name: FLJ23548
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046561: 97%, ENSRNOG00000026060: 52%
Entrez Gene ID: 79642
Uniprot ID: Q5FYB0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK
Gene Sequence TADPYERVDLSNRYPGIVKKLLRRLSQFNKTAVPVRYPPKDPRSNPRLNGGVWGPWYKEETKK
Gene ID - Mouse ENSMUSG00000046561
Gene ID - Rat ENSRNOG00000026060
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARSJ pAb (ATL-HPA036481)
Datasheet Anti ARSJ pAb (ATL-HPA036481) Datasheet (External Link)
Vendor Page Anti ARSJ pAb (ATL-HPA036481) at Atlas Antibodies

Documents & Links for Anti ARSJ pAb (ATL-HPA036481)
Datasheet Anti ARSJ pAb (ATL-HPA036481) Datasheet (External Link)
Vendor Page Anti ARSJ pAb (ATL-HPA036481)