Anti ARSI pAb (ATL-HPA038398)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038398-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ARSI
Alternative Gene Name: FLJ16069, SPG66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036412: 95%, ENSRNOG00000026060: 94%
Entrez Gene ID: 340075
Uniprot ID: Q5FYB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SADPYEREDLAGQRPDVVRTLLARLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEE |
| Gene Sequence | SADPYEREDLAGQRPDVVRTLLARLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEE |
| Gene ID - Mouse | ENSMUSG00000036412 |
| Gene ID - Rat | ENSRNOG00000026060 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARSI pAb (ATL-HPA038398) | |
| Datasheet | Anti ARSI pAb (ATL-HPA038398) Datasheet (External Link) |
| Vendor Page | Anti ARSI pAb (ATL-HPA038398) at Atlas Antibodies |
| Documents & Links for Anti ARSI pAb (ATL-HPA038398) | |
| Datasheet | Anti ARSI pAb (ATL-HPA038398) Datasheet (External Link) |
| Vendor Page | Anti ARSI pAb (ATL-HPA038398) |