Anti ARSI pAb (ATL-HPA038398)

Atlas Antibodies

Catalog No.: ATL-HPA038398-25

Protein Description: arylsulfatase family, member I
Gene Name: ARSI
Alternative Gene Name: FLJ16069, SPG66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036412: 95%, ENSRNOG00000026060: 94%
Entrez Gene ID: 340075
Uniprot ID: Q5FYB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SADPYEREDLAGQRPDVVRTLLARLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEE
• Gene Sequence: SADPYEREDLAGQRPDVVRTLLARLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEE
• Gene ID - Mouse: ENSMUSG00000036412
• Gene ID - Rat: ENSRNOG00000026060
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.