Anti ARSI pAb (ATL-HPA038398)

Atlas Antibodies

Catalog No.:
ATL-HPA038398-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: arylsulfatase family, member I
Gene Name: ARSI
Alternative Gene Name: FLJ16069, SPG66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036412: 95%, ENSRNOG00000026060: 94%
Entrez Gene ID: 340075
Uniprot ID: Q5FYB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SADPYEREDLAGQRPDVVRTLLARLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEE
Gene Sequence SADPYEREDLAGQRPDVVRTLLARLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEE
Gene ID - Mouse ENSMUSG00000036412
Gene ID - Rat ENSRNOG00000026060
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARSI pAb (ATL-HPA038398)
Datasheet Anti ARSI pAb (ATL-HPA038398) Datasheet (External Link)
Vendor Page Anti ARSI pAb (ATL-HPA038398) at Atlas Antibodies

Documents & Links for Anti ARSI pAb (ATL-HPA038398)
Datasheet Anti ARSI pAb (ATL-HPA038398) Datasheet (External Link)
Vendor Page Anti ARSI pAb (ATL-HPA038398)