Anti ARSI pAb (ATL-HPA038386)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038386-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ARSI
Alternative Gene Name: FLJ16069, SPG66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036412: 96%, ENSRNOG00000026060: 98%
Entrez Gene ID: 340075
Uniprot ID: Q5FYB1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TYDNCDGPGVCGFDLHEGENVAWGLSGQYSTMLYAQRASHILASHSPQRPLFLYVAFQAVHTPLQSPREYLYRYRTMGNVA |
Gene Sequence | TYDNCDGPGVCGFDLHEGENVAWGLSGQYSTMLYAQRASHILASHSPQRPLFLYVAFQAVHTPLQSPREYLYRYRTMGNVA |
Gene ID - Mouse | ENSMUSG00000036412 |
Gene ID - Rat | ENSRNOG00000026060 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARSI pAb (ATL-HPA038386) | |
Datasheet | Anti ARSI pAb (ATL-HPA038386) Datasheet (External Link) |
Vendor Page | Anti ARSI pAb (ATL-HPA038386) at Atlas Antibodies |
Documents & Links for Anti ARSI pAb (ATL-HPA038386) | |
Datasheet | Anti ARSI pAb (ATL-HPA038386) Datasheet (External Link) |
Vendor Page | Anti ARSI pAb (ATL-HPA038386) |