Anti ARSE pAb (ATL-HPA070651)

Atlas Antibodies

Catalog No.:
ATL-HPA070651-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: arylsulfatase E (chondrodysplasia punctata 1)
Gene Name: ARSE
Alternative Gene Name: CDPX, CDPX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040896: 32%, ENSRNOG00000028350: 52%
Entrez Gene ID: 415
Uniprot ID: P51690
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HFYGMPFSLMGDCARWELSEKRVNLEQKLNFLF
Gene Sequence HFYGMPFSLMGDCARWELSEKRVNLEQKLNFLF
Gene ID - Mouse ENSMUSG00000040896
Gene ID - Rat ENSRNOG00000028350
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARSE pAb (ATL-HPA070651)
Datasheet Anti ARSE pAb (ATL-HPA070651) Datasheet (External Link)
Vendor Page Anti ARSE pAb (ATL-HPA070651) at Atlas Antibodies

Documents & Links for Anti ARSE pAb (ATL-HPA070651)
Datasheet Anti ARSE pAb (ATL-HPA070651) Datasheet (External Link)
Vendor Page Anti ARSE pAb (ATL-HPA070651)