Anti ARSE pAb (ATL-HPA060518)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060518-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ARSE
Alternative Gene Name: CDPX, CDPX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045215: 32%, ENSRNOG00000028350: 49%
Entrez Gene ID: 415
Uniprot ID: P51690
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FVGALIVHADCFLMRNHTITEQPMCFQRTTPLILQEV |
| Gene Sequence | FVGALIVHADCFLMRNHTITEQPMCFQRTTPLILQEV |
| Gene ID - Mouse | ENSMUSG00000045215 |
| Gene ID - Rat | ENSRNOG00000028350 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARSE pAb (ATL-HPA060518) | |
| Datasheet | Anti ARSE pAb (ATL-HPA060518) Datasheet (External Link) |
| Vendor Page | Anti ARSE pAb (ATL-HPA060518) at Atlas Antibodies |
| Documents & Links for Anti ARSE pAb (ATL-HPA060518) | |
| Datasheet | Anti ARSE pAb (ATL-HPA060518) Datasheet (External Link) |
| Vendor Page | Anti ARSE pAb (ATL-HPA060518) |