Anti ARSD pAb (ATL-HPA063835)

Atlas Antibodies

Catalog No.:
ATL-HPA063835-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: arylsulfatase D
Gene Name: ARSD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034295: 38%, ENSRNOG00000002248: 39%
Entrez Gene ID: 414
Uniprot ID: P51689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FYGMPFTLTNDCDPGRPPEVDAALRAQLWGYTQFL
Gene Sequence FYGMPFTLTNDCDPGRPPEVDAALRAQLWGYTQFL
Gene ID - Mouse ENSMUSG00000034295
Gene ID - Rat ENSRNOG00000002248
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARSD pAb (ATL-HPA063835)
Datasheet Anti ARSD pAb (ATL-HPA063835) Datasheet (External Link)
Vendor Page Anti ARSD pAb (ATL-HPA063835) at Atlas Antibodies

Documents & Links for Anti ARSD pAb (ATL-HPA063835)
Datasheet Anti ARSD pAb (ATL-HPA063835) Datasheet (External Link)
Vendor Page Anti ARSD pAb (ATL-HPA063835)