Anti ARSD pAb (ATL-HPA004694)

Atlas Antibodies

SKU:
ATL-HPA004694-100
  • Immunohistochemical staining of human fallopian tube shows strong granular cytoplasmic positivity in glandular cells.
  • Western blot analysis in human cell line EFO-21.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: arylsulfatase D
Gene Name: ARSD
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015027: 27%, ENSRNOG00000032487: 50%
Entrez Gene ID: 414
Uniprot ID: P51689
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGAEARSAHEFLFHYCGQHLHAARWHQKDSGSVWKVHYTTPQFHPEGAGACYGRGVCPCSGEGVTHHRPPLLFDLSRDPSEARPLTPDSEPLYHAVIARVGAAVSEHRQTLSPVPQQFSMSNILWKPWLQPCCGHFPFCSCHED
Gene Sequence QGAEARSAHEFLFHYCGQHLHAARWHQKDSGSVWKVHYTTPQFHPEGAGACYGRGVCPCSGEGVTHHRPPLLFDLSRDPSEARPLTPDSEPLYHAVIARVGAAVSEHRQTLSPVPQQFSMSNILWKPWLQPCCGHFPFCSCHED
Gene ID - Mouse ENSMUSG00000015027
Gene ID - Rat ENSRNOG00000032487
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARSD pAb (ATL-HPA004694)
Datasheet Anti ARSD pAb (ATL-HPA004694) Datasheet (External Link)
Vendor Page Anti ARSD pAb (ATL-HPA004694) at Atlas Antibodies

Documents & Links for Anti ARSD pAb (ATL-HPA004694)
Datasheet Anti ARSD pAb (ATL-HPA004694) Datasheet (External Link)
Vendor Page Anti ARSD pAb (ATL-HPA004694)