Anti ARSB pAb (ATL-HPA037771 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA037771-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: arylsulfatase B
Gene Name: ARSB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042082: 80%, ENSRNOG00000011150: 80%
Entrez Gene ID: 411
Uniprot ID: P15848
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVT
Gene Sequence TRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVT
Gene ID - Mouse ENSMUSG00000042082
Gene ID - Rat ENSRNOG00000011150
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARSB pAb (ATL-HPA037771 w/enhanced validation)
Datasheet Anti ARSB pAb (ATL-HPA037771 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARSB pAb (ATL-HPA037771 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARSB pAb (ATL-HPA037771 w/enhanced validation)
Datasheet Anti ARSB pAb (ATL-HPA037771 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARSB pAb (ATL-HPA037771 w/enhanced validation)