Anti ARSB pAb (ATL-HPA037770)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037770-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ARSB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042082: 80%, ENSRNOG00000011150: 82%
Entrez Gene ID: 411
Uniprot ID: P15848
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | YPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYF |
| Gene Sequence | YPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYF |
| Gene ID - Mouse | ENSMUSG00000042082 |
| Gene ID - Rat | ENSRNOG00000011150 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARSB pAb (ATL-HPA037770) | |
| Datasheet | Anti ARSB pAb (ATL-HPA037770) Datasheet (External Link) |
| Vendor Page | Anti ARSB pAb (ATL-HPA037770) at Atlas Antibodies |
| Documents & Links for Anti ARSB pAb (ATL-HPA037770) | |
| Datasheet | Anti ARSB pAb (ATL-HPA037770) Datasheet (External Link) |
| Vendor Page | Anti ARSB pAb (ATL-HPA037770) |