Anti ARRDC4 pAb (ATL-HPA042109)

Atlas Antibodies

Catalog No.:
ATL-HPA042109-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: arrestin domain containing 4
Gene Name: ARRDC4
Alternative Gene Name: FLJ36045
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042659: 81%, ENSRNOG00000010775: 83%
Entrez Gene ID: 91947
Uniprot ID: Q8NCT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGSRNSSIASQFSMDMSWLTLTLPEQPEAPPNYADVVSEEEFSRHIPPYPQPPNCEGEVCCPVFACIQEF
Gene Sequence FGSRNSSIASQFSMDMSWLTLTLPEQPEAPPNYADVVSEEEFSRHIPPYPQPPNCEGEVCCPVFACIQEF
Gene ID - Mouse ENSMUSG00000042659
Gene ID - Rat ENSRNOG00000010775
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARRDC4 pAb (ATL-HPA042109)
Datasheet Anti ARRDC4 pAb (ATL-HPA042109) Datasheet (External Link)
Vendor Page Anti ARRDC4 pAb (ATL-HPA042109) at Atlas Antibodies

Documents & Links for Anti ARRDC4 pAb (ATL-HPA042109)
Datasheet Anti ARRDC4 pAb (ATL-HPA042109) Datasheet (External Link)
Vendor Page Anti ARRDC4 pAb (ATL-HPA042109)