Anti ARRDC2 pAb (ATL-HPA074216)

Atlas Antibodies

Catalog No.:
ATL-HPA074216-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: arrestin domain containing 2
Gene Name: ARRDC2
Alternative Gene Name: CLONE24945, PP2703
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002910: 82%, ENSRNOG00000019009: 83%
Entrez Gene ID: 27106
Uniprot ID: Q8TBH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLFDKVKAFSVQLDGATAGVEPVFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWT
Gene Sequence MLFDKVKAFSVQLDGATAGVEPVFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWT
Gene ID - Mouse ENSMUSG00000002910
Gene ID - Rat ENSRNOG00000019009
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARRDC2 pAb (ATL-HPA074216)
Datasheet Anti ARRDC2 pAb (ATL-HPA074216) Datasheet (External Link)
Vendor Page Anti ARRDC2 pAb (ATL-HPA074216) at Atlas Antibodies

Documents & Links for Anti ARRDC2 pAb (ATL-HPA074216)
Datasheet Anti ARRDC2 pAb (ATL-HPA074216) Datasheet (External Link)
Vendor Page Anti ARRDC2 pAb (ATL-HPA074216)