Anti ARRDC1 pAb (ATL-HPA044345 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA044345-100

• 
• 

Protein Description: arrestin domain containing 1
Gene Name: ARRDC1
Alternative Gene Name: MGC40555
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026972: 91%, ENSRNOG00000007622: 92%
Entrez Gene ID: 92714
Uniprot ID: Q8N5I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IHTPRFSKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVGQALQLHADVE
• Gene Sequence: IHTPRFSKDHKCSLVFYILSPLNLNSIPDIEQPNVASATKKFSYKLVKTGSVVLTASTDLRGYVVGQALQLHADVE
• Gene ID - Mouse: ENSMUSG00000026972
• Gene ID - Rat: ENSRNOG00000007622
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.